Lineage for d3bt2a2 (3bt2 A:50-132)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461545Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1461546Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1461547Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1461628Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 1461629Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries)
  8. 1461635Domain d3bt2a2: 3bt2 A:50-132 [155541]
    Other proteins in same PDB: d3bt2a1, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
    automatically matched to d1urka2
    complexed with nag

Details for d3bt2a2

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3bt2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt2a2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

SCOPe Domain Coordinates for d3bt2a2:

Click to download the PDB-style file with coordinates for d3bt2a2.
(The format of our PDB-style files is described here.)

Timeline for d3bt2a2: