Lineage for d3bt2a1 (3bt2 A:9-49)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636286Protein Plasminogen activator (urokinase-type) [57221] (1 species)
  7. 2636287Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries)
  8. 2636292Domain d3bt2a1: 3bt2 A:9-49 [155540]
    Other proteins in same PDB: d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
    automated match to d1urka1
    complexed with nag

Details for d3bt2a1

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3bt2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt2a1 g.3.11.1 (A:9-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
sncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

SCOPe Domain Coordinates for d3bt2a1:

Click to download the PDB-style file with coordinates for d3bt2a1.
(The format of our PDB-style files is described here.)

Timeline for d3bt2a1: