SCOPe 2.04: Domain d1g0bb_: 1g0b B:

Lineage for d1g0bb_ (1g0b B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (16 PDB entries)

8. Domain d1g0bb_: 1g0b B: [15554]
   Other proteins in same PDB: d1g0ba_
   complexed with cmo, hem

Details for d1g0bb_

PDB Entry: 1g0b, 1.9 Å

PDB Description: carbonmonoxy liganded equine hemoglobin ph 8.5

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1g0bb_:

Sequence; same for both SEQRES and ATOM records:

>d1g0bb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d1g0bb_:

• d1g0bb_ first appeared (with stable ids) in SCOP 1.55
  
• d1g0bb_ appears in SCOPe 2.03
  
• d1g0bb_ appears in SCOPe 2.05
  
• d1g0bb_ appears in the current release, SCOPe 2.08