Lineage for d1g0bb_ (1g0b B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 902583Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 902671Species Horse (Equus caballus) [TaxId:9796] [46504] (14 PDB entries)
  8. 902675Domain d1g0bb_: 1g0b B: [15554]
    Other proteins in same PDB: d1g0ba_
    complexed with cmo, hem

Details for d1g0bb_

PDB Entry: 1g0b (more details), 1.9 Å

PDB Description: carbonmonoxy liganded equine hemoglobin ph 8.5
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1g0bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0bb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d1g0bb_:

Click to download the PDB-style file with coordinates for d1g0bb_.
(The format of our PDB-style files is described here.)

Timeline for d1g0bb_: