Lineage for d1g0bb_ (1g0b B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44276Species Horse (Equus caballus) [TaxId:9796] [46504] (4 PDB entries)
  8. 44278Domain d1g0bb_: 1g0b B: [15554]
    Other proteins in same PDB: d1g0ba_

Details for d1g0bb_

PDB Entry: 1g0b (more details), 1.9 Å

PDB Description: carbonmonoxy liganded equine hemoglobin ph 8.5

SCOP Domain Sequences for d1g0bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0bb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus)}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOP Domain Coordinates for d1g0bb_:

Click to download the PDB-style file with coordinates for d1g0bb_.
(The format of our PDB-style files is described here.)

Timeline for d1g0bb_: