Lineage for d1g0bb_ (1g0b B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin, beta-chain [46500] (15 species) 
Species Horse (Equus caballus) [TaxId:9796] [46504] (4 PDB entries) 
Domain d1g0bb_: 1g0b B: [15554]
Other proteins in same PDB: d1g0ba_
Details for d1g0bb_
PDB Entry: 1g0b (more details), 1.9 Å
PDB Description: carbonmonoxy liganded equine hemoglobin ph 8.5
SCOP Domain Sequences for d1g0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0bb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus)}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh
SCOP Domain Coordinates for d1g0bb_:
Click to download the PDB-style file with coordinates for d1g0bb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g0bb_:
- d1g0bb_ appears in SCOP 1.57
- d1g0bb_ appears in the current release, SCOPe 2.08
View in 3D
