Lineage for d3bt1u2 (3bt1 U:188-275)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637112Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2637186Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 2637187Species Human (Homo sapiens) [TaxId:9606] [161129] (6 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 2637219Domain d3bt1u2: 3bt1 U:188-275 [155538]
    Other proteins in same PDB: d3bt1a1, d3bt1a2, d3bt1b_
    automated match to d2i9be1
    complexed with nag

Details for d3bt1u2

PDB Entry: 3bt1 (more details), 2.8 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d3bt1u2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt1u2 g.7.1.3 (U:188-275) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
pqngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmc
qhahlgdafsmnhidvscctksgcnhpd

SCOPe Domain Coordinates for d3bt1u2:

Click to download the PDB-style file with coordinates for d3bt1u2.
(The format of our PDB-style files is described here.)

Timeline for d3bt1u2: