SCOP 1.75: Domain d3bsyc1: 3bsy C:3-195

Lineage for d3bsyc1 (3bsy C:3-195)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.8: PglD-like [159280] (1 protein)
   contains extra N-terminal alpha/beta subdomain
   this is a repeat family; one repeat unit is 2npo A:101-119 found in domain

6. Protein Acetyltransferase PglD [159281] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [159282] (6 PDB entries)
   Uniprot Q0P9D1 3-197

8. Domain d3bsyc1: 3bsy C:3-195 [155533]
   automatically matched to 2NPO A:3-197
   complexed with aco

Details for d3bsyc1

PDB Entry: 3bsy, 1.8 Å

PDB Description: pgld from campylobacter jejuni, nctc 11168, in complex with acetyl coenzyme a

PDB Compounds: (C:) Acetyltransferase

SCOP Domain Sequences for d3bsyc1:

Sequence; same for both SEQRES and ATOM records:

>d3bsyc1 b.81.1.8 (C:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
rtekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirk
kiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssv
iehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqd
ekgvfvgvpakrm

Timeline for d3bsyc1:

• d3bsyc1 is new in SCOP 1.75
  
• d3bsyc1 is called d3bsyc_ in SCOPe 2.01
  
• d3bsyc1 appears in the current release, SCOPe 2.08, called d3bsyc_