![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (22 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [46504] (10 PDB entries) |
![]() | Domain d1ibeb_: 1ibe B: [15553] Other proteins in same PDB: d1ibea_ complexed with hem |
PDB Entry: 1ibe (more details), 1.8 Å
SCOP Domain Sequences for d1ibeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibeb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahkyh
Timeline for d1ibeb_: