Lineage for d1ibeb_ (1ibe B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687104Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries)
  8. 2687114Domain d1ibeb_: 1ibe B: [15553]
    Other proteins in same PDB: d1ibea_
    complexed with hem

Details for d1ibeb_

PDB Entry: 1ibe (more details), 1.8 Å

PDB Description: deoxy-haemoglobin trapped in the high-affinity (r) state
PDB Compounds: (B:) hemoglobin (deoxy)

SCOPe Domain Sequences for d1ibeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibeb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d1ibeb_:

Click to download the PDB-style file with coordinates for d1ibeb_.
(The format of our PDB-style files is described here.)

Timeline for d1ibeb_: