SCOPe 2.06: Domain d3bswa_: 3bsw A:

Lineage for d3bswa_ (3bsw A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.8: PglD-like [159280] (2 proteins)
   contains extra N-terminal alpha/beta subdomain
   this is a repeat family; one repeat unit is 2npo A:101-119 found in domain

6. Protein Acetyltransferase PglD [159281] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [159282] (6 PDB entries)
   Uniprot Q0P9D1 3-197

8. Domain d3bswa_: 3bsw A: [155528]
   automated match to d2npoa1
   complexed with cit

Details for d3bswa_

PDB Entry: 3bsw, 1.77 Å

PDB Description: pgld-citrate complex, from campylobacter jejuni nctc 11168

PDB Compounds: (A:) Acetyltransferase

SCOPe Domain Sequences for d3bswa_:

Sequence, based on SEQRES records:

>d3bswa_ b.81.1.8 (A:) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
rtekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirk
kiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssv
iehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqd
ekgvfvgvpakrm

Sequence, based on observed residues (ATOM records):

>d3bswa_ b.81.1.8 (A:) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
rtekiyiygghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirkki
yqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvie
hecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqdek
gvfvgvpakrm

Timeline for d3bswa_:

• d3bswa_ first appeared in SCOP 1.75, called d3bswa1
  
• d3bswa_ appears in SCOPe 2.05
  
• d3bswa_ appears in SCOPe 2.07
  
• d3bswa_ appears in the current release, SCOPe 2.08