SCOPe 2.07: Domain d3bsga2: 3bsg A:1-347

Lineage for d3bsga2 (3bsg A:1-347)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (26 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [255684] (8 PDB entries)

8. Domain d3bsga2: 3bsg A:1-347 [155526]
   Other proteins in same PDB: d3bsga1
   automated match to d1ht6a2
   complexed with ca; mutant

Details for d3bsga2

PDB Entry: 3bsg, 1.95 Å

PDB Description: Barley alpha-amylase isozyme 1 (AMY1) H395A mutant

PDB Compounds: (A:) Alpha-amylase type A isozyme

SCOPe Domain Sequences for d3bsga2:

Sequence; same for both SEQRES and ATOM records:

>d3bsga2 c.1.8.1 (A:1-347) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng

Timeline for d3bsga2:

• d3bsga2 first appeared in SCOP 1.75
  
• d3bsga2 appears in SCOPe 2.06