Lineage for d3bsda_ (3bsd A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068796Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
    single sheet; 16 strands; meander
  4. 2068797Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) (S)
    automatically mapped to Pfam PF02327
  5. 2068798Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 protein domains)
  6. 2068808Protein automated matches [190386] (3 species)
    not a true protein
  7. 2068809Species Chlorobaculum tepidum [TaxId:1097] [187240] (2 PDB entries)
  8. 2068810Domain d3bsda_: 3bsd A: [155524]
    automated match to d1ksaa_
    complexed with bcl, mg

Details for d3bsda_

PDB Entry: 3bsd (more details), 2.3 Å

PDB Description: light harvesting protein from rc of chlorobium tepidum
PDB Compounds: (A:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d3bsda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bsda_ b.75.1.1 (A:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
dvttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvri
savfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrs
davrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfig
paftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdk
lnrpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnf
nvdaqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq

SCOPe Domain Coordinates for d3bsda_:

Click to download the PDB-style file with coordinates for d3bsda_.
(The format of our PDB-style files is described here.)

Timeline for d3bsda_: