Lineage for d3bsba_ (3bsb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725793Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
    this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
  6. 2725794Protein Pumilio 1 [63612] (1 species)
  7. 2725795Species Human (Homo sapiens) [TaxId:9606] [63613] (13 PDB entries)
  8. 2725817Domain d3bsba_: 3bsb A: [155522]
    automated match to d1m8yb_
    protein/RNA complex

Details for d3bsba_

PDB Entry: 3bsb (more details), 2.8 Å

PDB Description: crystal structure of human pumilio1 in complex with cyclinb reverse rna
PDB Compounds: (A:) Pumilio homolog 1

SCOPe Domain Sequences for d3bsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bsba_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
rsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilqa
ayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefipsd
qqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygcr
viqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirgn
vlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqkm
idvaepgqrkivmhkirphiatlrkytygkhilaklekyy

SCOPe Domain Coordinates for d3bsba_:

Click to download the PDB-style file with coordinates for d3bsba_.
(The format of our PDB-style files is described here.)

Timeline for d3bsba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bsbb_