Lineage for d3brxa2 (3brx A:7-321)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000111Protein automated matches [190368] (3 species)
    not a true protein
  7. 2000112Species Cotton (Gossypium hirsutum) [TaxId:3635] [187206] (1 PDB entry)
  8. 2000113Domain d3brxa2: 3brx A:7-321 [155521]
    Other proteins in same PDB: d3brxa3
    automated match to d1n00a_
    complexed with ca, po4

Details for d3brxa2

PDB Entry: 3brx (more details), 2.5 Å

PDB Description: Crystal Structure of calcium-bound cotton annexin Gh1
PDB Compounds: (A:) Annexin

SCOPe Domain Sequences for d3brxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brxa2 a.65.1.1 (A:7-321) automated matches {Cotton (Gossypium hirsutum) [TaxId: 3635]}
atltvpttvpsvsedceqlrkafsgwgtnegliidilghrnaeqrnlirktyaetygedl
lkaldkelsndferlvllwaldpaerdallaneatkrwtssnqvlmeiactrsanqllha
rqayharykksleedvahhttgdfhklllplvssyryegeevnmtlakteakllhekisn
kaysdddvirvlatrskaqinatlnhykneygndinkdlkadpkdeflallrstvkclvy
pekyfekvlrlainrrgtdegaltrvvctraevdlkviadeyqrrnsvpltraivkdthg
dyeklllvlaghven

SCOPe Domain Coordinates for d3brxa2:

Click to download the PDB-style file with coordinates for d3brxa2.
(The format of our PDB-style files is described here.)

Timeline for d3brxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3brxa3