Lineage for d3brod_ (3bro D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693794Protein Transcriptional regulator OEOE1854 [158276] (1 species)
  7. 2693795Species Oenococcus oeni [TaxId:1247] [158277] (1 PDB entry)
    Uniprot Q04CY6 3-137
  8. 2693799Domain d3brod_: 3bro D: [155520]
    Other proteins in same PDB: d3brob3
    automated match to d3broa1
    complexed with cl, gol

Details for d3brod_

PDB Entry: 3bro (more details), 2.04 Å

PDB Description: Crystal structure of the transcription regulator MarR from Oenococcus oeni PSU-1
PDB Compounds: (D:) Transcriptional regulator

SCOPe Domain Sequences for d3brod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brod_ a.4.5.28 (D:) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]}
dlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsiksst
atvllqrmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsglnkee
vvflekilkrmies

SCOPe Domain Coordinates for d3brod_:

Click to download the PDB-style file with coordinates for d3brod_.
(The format of our PDB-style files is described here.)

Timeline for d3brod_: