Lineage for d1a9wf_ (1a9w F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687739Species Human (Homo sapiens), embryonic gower II [TaxId:9606] [46503] (1 PDB entry)
  8. 2687741Domain d1a9wf_: 1a9w F: [15552]
    Other proteins in same PDB: d1a9wa_, d1a9wc_
    complexed with cmo, hem

Details for d1a9wf_

PDB Entry: 1a9w (more details), 2.9 Å

PDB Description: human embryonic gower ii carbonmonoxy hemoglobin
PDB Compounds: (F:) hemoglobin (beta chain)

SCOPe Domain Sequences for d1a9wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9wf_ a.1.1.2 (F:) Hemoglobin, beta-chain {Human (Homo sapiens), embryonic gower II [TaxId: 9606]}
vhftaeekaavtslwskmnveeaggealgrllvvypwtqrffdsfgnlsspsailgnpkv
kahgkkvltsfgdaiknmdnlkpafaklselhcdklhvdpenfkllgnvmviilathfgk
eftpevqaawqklvsavaialahky

SCOPe Domain Coordinates for d1a9wf_:

Click to download the PDB-style file with coordinates for d1a9wf_.
(The format of our PDB-style files is described here.)

Timeline for d1a9wf_: