SCOP 1.75: Domain d3broc1: 3bro C:4-137

Lineage for d3broc1 (3bro C:4-137)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (19 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Transcriptional regulator OEOE1854 [158276] (1 species)

7. Species Oenococcus oeni [TaxId:1247] [158277] (1 PDB entry)
   Uniprot Q04CY6 3-137

8. Domain d3broc1: 3bro C:4-137 [155519]
   automatically matched to 3BRO A:3-137
   complexed with cl, gol

Details for d3broc1

PDB Entry: 3bro, 2.04 Å

PDB Description: Crystal structure of the transcription regulator MarR from Oenococcus oeni PSU-1

PDB Compounds: (C:) Transcriptional regulator

SCOP Domain Sequences for d3broc1:

Sequence; same for both SEQRES and ATOM records:

>d3broc1 a.4.5.28 (C:4-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]}
dlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsiksst
atvllqrmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsglnkee
vvflekilkrmies

Timeline for d3broc1:

• d3broc1 is new in SCOP 1.75
  
• d3broc1 is called d3broc_ in SCOPe 2.01
  
• d3broc1 appears in the current release, SCOPe 2.08, called d3broc_