SCOPe 2.08: Domain d3brob2: 3bro B:1-138

Lineage for d3brob2 (3bro B:1-138)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Transcriptional regulator OEOE1854 [158276] (1 species)

7. Species Oenococcus oeni [TaxId:1247] [158277] (1 PDB entry)
   Uniprot Q04CY6 3-137

8. Domain d3brob2: 3bro B:1-138 [155518]
   Other proteins in same PDB: d3brob3
   automated match to d3broa1
   complexed with cl, gol

Details for d3brob2

PDB Entry: 3bro, 2.04 Å

PDB Description: Crystal structure of the transcription regulator MarR from Oenococcus oeni PSU-1

PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d3brob2:

Sequence; same for both SEQRES and ATOM records:

>d3brob2 a.4.5.28 (B:1-138) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]}
msrdlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsik
sstatvllqrmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsgln
keevvflekilkrmiesd

Timeline for d3brob2:

• d3brob2 first appeared in SCOP 1.75, called d3brob1
  
• d3brob2 appears in SCOPe 2.07