| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
| Protein Transcriptional regulator OEOE1854 [158276] (1 species) |
| Species Oenococcus oeni [TaxId:1247] [158277] (1 PDB entry) Uniprot Q04CY6 3-137 |
| Domain d3brob2: 3bro B:1-138 [155518] Other proteins in same PDB: d3brob3 automated match to d3broa1 complexed with cl, gol |
PDB Entry: 3bro (more details), 2.04 Å
SCOPe Domain Sequences for d3brob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3brob2 a.4.5.28 (B:1-138) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]}
msrdlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsik
sstatvllqrmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsgln
keevvflekilkrmiesd
Timeline for d3brob2: