Lineage for d3brjb_ (3brj B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2352129Fold a.285: MtlR-like [158667] (1 superfamily)
    multihelical; 8-helical up-and-down bundle
  4. 2352130Superfamily a.285.1: MtlR-like [158668] (1 family) (S)
    automatically mapped to Pfam PF05068
  5. 2352131Family a.285.1.1: MtlR-like [158669] (2 proteins)
    Pfam PF05068; mannitol repressor
  6. 2352132Protein Mannitol operon repressor MtlR [158672] (1 species)
  7. 2352133Species Vibrio parahaemolyticus [TaxId:670] [158673] (1 PDB entry)
    Uniprot Q87SQ4 6-172
  8. 2352135Domain d3brjb_: 3brj B: [155512]
    automated match to d3brja1
    complexed with edo, gol

Details for d3brjb_

PDB Entry: 3brj (more details), 2.75 Å

PDB Description: Crystal structure of mannitol operon repressor (MtlR) from Vibrio parahaemolyticus RIMD 2210633
PDB Compounds: (B:) Mannitol operon repressor

SCOPe Domain Sequences for d3brjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brjb_ a.285.1.1 (B:) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]}
nineseiierlnsapsvrgffiatvdvfnesidgliqrifrkdnfavqsvvgpllqdsgp
lgdlsvrlkllfglgvlpddiyhdiediiklknhlnsdasdyeftdpnilepikklhlvk
kmgmvqlevnepdddidlefyqlqlqrqqqiiksglslaiveicnelgk

SCOPe Domain Coordinates for d3brjb_:

Click to download the PDB-style file with coordinates for d3brjb_.
(The format of our PDB-style files is described here.)

Timeline for d3brjb_: