SCOPe 2.08: Domain d3brjb_: 3brj B:

Lineage for d3brjb_ (3brj B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.285: MtlR-like [158667] (1 superfamily)
   multihelical; 8-helical up-and-down bundle

4. Superfamily a.285.1: MtlR-like [158668] (1 family)
   automatically mapped to Pfam PF05068

5. Family a.285.1.1: MtlR-like [158669] (2 proteins)
   Pfam PF05068; mannitol repressor

6. Protein Mannitol operon repressor MtlR [158672] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [158673] (1 PDB entry)
   Uniprot Q87SQ4 6-172

8. Domain d3brjb_: 3brj B: [155512]
   automated match to d3brja1
   complexed with edo, gol

Details for d3brjb_

PDB Entry: 3brj, 2.75 Å

PDB Description: Crystal structure of mannitol operon repressor (MtlR) from Vibrio parahaemolyticus RIMD 2210633

PDB Compounds: (B:) Mannitol operon repressor

SCOPe Domain Sequences for d3brjb_:

Sequence; same for both SEQRES and ATOM records:

>d3brjb_ a.285.1.1 (B:) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]}
nineseiierlnsapsvrgffiatvdvfnesidgliqrifrkdnfavqsvvgpllqdsgp
lgdlsvrlkllfglgvlpddiyhdiediiklknhlnsdasdyeftdpnilepikklhlvk
kmgmvqlevnepdddidlefyqlqlqrqqqiiksglslaiveicnelgk

Timeline for d3brjb_:

• d3brjb_ first appeared in SCOP 1.75, called d3brjb1
  
• d3brjb_ appears in SCOPe 2.07