Lineage for d3brfa3 (3brf A:381-541)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 801200Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (1 family) (S)
    contains rudiment hairpin triplet lacking one hairpin
  5. 801201Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein)
  6. 801202Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species)
  7. 801203Species Caenorhabditis elegans [TaxId:6239] [110220] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 801205Domain d3brfa3: 3brf A:381-541 [155510]
    Other proteins in same PDB: d3brfa1, d3brfa2
    automatically matched to d1ttua3
    complexed with sor

Details for d3brfa3

PDB Entry: 3brf (more details), 2.47 Å

PDB Description: csl (lag-1) bound to dna with lin-12 ram peptide, c2221
PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform a

SCOP Domain Sequences for d3brfa3:

Sequence, based on SEQRES records: (download)

>d3brfa3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd
nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm
idnelvylclshdkiiqhqatainehrhqindgaawtiist

Sequence, based on observed residues (ATOM records): (download)

>d3brfa3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfddeqetdnfa
vrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqmidn
elvylclshdkiiqhqatainehrhqindgaawtiist

SCOP Domain Coordinates for d3brfa3:

Click to download the PDB-style file with coordinates for d3brfa3.
(The format of our PDB-style files is described here.)

Timeline for d3brfa3: