Lineage for d1a9we_ (1a9w E:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759471Species Human (Homo sapiens), embryonic gower II [TaxId:9606] [46503] (1 PDB entry)
  8. 759472Domain d1a9we_: 1a9w E: [15551]
    Other proteins in same PDB: d1a9wa_, d1a9wc_

Details for d1a9we_

PDB Entry: 1a9w (more details), 2.9 Å

PDB Description: human embryonic gower ii carbonmonoxy hemoglobin
PDB Compounds: (E:) hemoglobin (beta chain)

SCOP Domain Sequences for d1a9we_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9we_ a.1.1.2 (E:) Hemoglobin, beta-chain {Human (Homo sapiens), embryonic gower II [TaxId: 9606]}
vhftaeekaavtslwskmnveeaggealgrllvvypwtqrffdsfgnlsspsailgnpkv
kahgkkvltsfgdaiknmdnlkpafaklselhcdklhvdpenfkllgnvmviilathfgk
eftpevqaawqklvsavaialahky

SCOP Domain Coordinates for d1a9we_:

Click to download the PDB-style file with coordinates for d1a9we_.
(The format of our PDB-style files is described here.)

Timeline for d1a9we_: