Lineage for d3brfa1 (3brf A:542-660)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 788951Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 788959Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species)
  7. 788960Species Caenorhabditis elegans [TaxId:6239] [110053] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 788962Domain d3brfa1: 3brf A:542-660 [155508]
    Other proteins in same PDB: d3brfa2, d3brfa3
    automatically matched to d1ttua1
    complexed with sor

Details for d3brfa1

PDB Entry: 3brf (more details), 2.47 Å

PDB Description: csl (lag-1) bound to dna with lin-12 ram peptide, c2221
PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform a

SCOP Domain Sequences for d3brfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brfa1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet
tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks

SCOP Domain Coordinates for d3brfa1:

Click to download the PDB-style file with coordinates for d3brfa1.
(The format of our PDB-style files is described here.)

Timeline for d3brfa1: