![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (2 families) ![]() contains rudiment hairpin triplet lacking one hairpin automatically mapped to Pfam PF09270 |
![]() | Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein) |
![]() | Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110220] (4 PDB entries) Uniprot Q9TYY1 195-660 |
![]() | Domain d3brda3: 3brd A:381-541 [155507] Other proteins in same PDB: d3brda1, d3brda2 automated match to d1ttua3 protein/DNA complex; complexed with edo |
PDB Entry: 3brd (more details), 2.21 Å
SCOPe Domain Sequences for d3brda3:
Sequence, based on SEQRES records: (download)
>d3brda3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm idnelvylclshdkiiqhqatainehrhqindgaawtiist
>d3brda3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfddqetdnfav rdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqmidne lvylclshdkiiqhqatainehrhqindgaawtiist
Timeline for d3brda3: