![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110053] (4 PDB entries) Uniprot Q9TYY1 195-660 |
![]() | Domain d3brda1: 3brd A:542-660 [155505] Other proteins in same PDB: d3brda2, d3brda3 automatically matched to d1ttua1 protein/DNA complex; complexed with edo |
PDB Entry: 3brd (more details), 2.21 Å
SCOPe Domain Sequences for d3brda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks
Timeline for d3brda1: