Lineage for d3brda1 (3brd A:542-660)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937487Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 937495Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species)
  7. 937496Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110053] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 937497Domain d3brda1: 3brd A:542-660 [155505]
    Other proteins in same PDB: d3brda2, d3brda3
    automatically matched to d1ttua1
    protein/DNA complex; complexed with edo

Details for d3brda1

PDB Entry: 3brd (more details), 2.21 Å

PDB Description: csl (lag-1) bound to dna with lin-12 ram peptide, p212121
PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform a

SCOPe Domain Sequences for d3brda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet
tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks

SCOPe Domain Coordinates for d3brda1:

Click to download the PDB-style file with coordinates for d3brda1.
(The format of our PDB-style files is described here.)

Timeline for d3brda1: