Lineage for d3bqoa1 (3bqo A:62-265)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926529Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 926530Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
  5. 926531Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (2 proteins)
  6. 926532Protein TRF1 [63602] (1 species)
  7. 926533Species Human (Homo sapiens) [TaxId:9606] [63603] (2 PDB entries)
  8. 926534Domain d3bqoa1: 3bqo A:62-265 [155503]
    automatically matched to d1h6oa_
    protein/DNA complex

Details for d3bqoa1

PDB Entry: 3bqo (more details), 2 Å

PDB Description: Crystal Structure of TRF1 TRFH domain and TIN2 peptide complex
PDB Compounds: (A:) Telomeric repeat-binding factor 1

SCOPe Domain Sequences for d3bqoa1:

Sequence, based on SEQRES records: (download)

>d3bqoa1 a.146.1.1 (A:62-265) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
edaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlr
tiyicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqai
avcmengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekik
syvnyvlseksstflmkaaakvve

Sequence, based on observed residues (ATOM records): (download)

>d3bqoa1 a.146.1.1 (A:62-265) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
edaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlr
tiyicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqai
avcmengnfkeaeevferifhmpfkskllmiisqkdtfhsffqhfsynhmmekiksyvny
vlseksstflmkaaakvve

SCOPe Domain Coordinates for d3bqoa1:

Click to download the PDB-style file with coordinates for d3bqoa1.
(The format of our PDB-style files is described here.)

Timeline for d3bqoa1: