Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (25 species) |
Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries) |
Domain d1fdhg_: 1fdh G: [15550] Other proteins in same PDB: d1fdha_, d1fdhb_ complexed with hem |
PDB Entry: 1fdh (more details), 2.5 Å
SCOPe Domain Sequences for d1fdhg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdhg_ a.1.1.2 (G:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain [TaxId: 9606]} ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk eftpevqaswqkmvtgvasalssryh
Timeline for d1fdhg_: