![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (22 species) |
![]() | Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries) |
![]() | Domain d1fdhg_: 1fdh G: [15550] Other proteins in same PDB: d1fdha_ complexed with hem |
PDB Entry: 1fdh (more details), 2.5 Å
SCOP Domain Sequences for d1fdhg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdhg_ a.1.1.2 (G:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain} ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk eftpevqaswqkmvtgvasalssryh
Timeline for d1fdhg_: