Lineage for d1fdhg_ (1fdh G:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin, beta-chain [46500] (15 species) 
Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (1 PDB entry) 
Domain d1fdhg_: 1fdh G: [15550]
Other proteins in same PDB: d1fdha_
Details for d1fdhg_
PDB Entry: 1fdh (more details), 2.5 Å
PDB Description: structure of human foetal deoxyhaemoglobin
SCOP Domain Sequences for d1fdhg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdhg_ a.1.1.2 (G:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh
SCOP Domain Coordinates for d1fdhg_:
Click to download the PDB-style file with coordinates for d1fdhg_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fdhg_:
- d1fdhg_ appears in SCOP 1.57
- d1fdhg_ appears in the current release, SCOPe 2.08
View in 3D
