SCOP 1.75: Domain d3bq1a2: 3bq1 A:1-239

Lineage for d3bq1a2 (3bq1 A:1-239)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DinB homolog (DBH) [100889] (3 species)

7. Species Sulfolobus acidocaldarius Brock et al. 1972 (Sulfolobus acidocaldarius) [TaxId:2285] [160954] (3 PDB entries)

8. Domain d3bq1a2: 3bq1 A:1-239 [155494]
   Other proteins in same PDB: d3bq1a1
   automatically matched to d1k1qa2
   complexed with ca, dg3

Details for d3bq1a2

PDB Entry: 3bq1, 2.7 Å

PDB Description: Insertion ternary complex of Dbh DNA polymerase

PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d3bq1a2:

Sequence; same for both SEQRES and ATOM records:

>d3bq1a2 e.8.1.7 (A:1-239) DinB homolog (DBH) {Sulfolobus acidocaldarius Brock et al. 1972 (Sulfolobus acidocaldarius) [TaxId: 2285]}
mivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgvkagmp
iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepve

Timeline for d3bq1a2:

• d3bq1a2 is new in SCOP 1.75
  
• d3bq1a2 appears in SCOPe 2.01
  
• d3bq1a2 appears in the current release, SCOPe 2.08