SCOP 1.59: Domain d1hbsh_: 1hbs H:

Lineage for d1hbsh_ (1hbs H:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (76 PDB entries)

8. Domain d1hbsh_: 1hbs H: [15549]
   Other proteins in same PDB: d1hbsa_, d1hbsc_, d1hbse_, d1hbsg_

Details for d1hbsh_

PDB Entry: 1hbs, 3 Å

PDB Description: refined crystal structure of deoxyhemoglobin s. i. restrained least-squares refinement at 3.0-angstroms resolution

SCOP Domain Sequences for d1hbsh_:

Sequence; same for both SEQRES and ATOM records:

>d1hbsh_ a.1.1.2 (H:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1hbsh_:

• d1hbsh_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbsh_ appears in SCOP 1.57
  
• d1hbsh_ appears in SCOP 1.61
  
• d1hbsh_ appears in the current release, SCOPe 2.08