Lineage for d3bpse1 (3bps E:293-332)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889862Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 889863Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
    Uniprot P01130 272-353
  8. 889866Domain d3bpse1: 3bps E:293-332 [155489]
    automatically matched to d1hj7a1
    complexed with ca

Details for d3bpse1

PDB Entry: 3bps (more details), 2.41 Å

PDB Description: PCSK9:EGF-A complex
PDB Compounds: (E:) low-density lipoprotein receptor

SCOP Domain Sequences for d3bpse1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

SCOP Domain Coordinates for d3bpse1:

Click to download the PDB-style file with coordinates for d3bpse1.
(The format of our PDB-style files is described here.)

Timeline for d3bpse1: