SCOPe 2.06: Domain d3bpna_: 3bpn A:

Lineage for d3bpna_ (3bpn A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-4 (IL-4) [47291] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47292] (17 PDB entries)

8. Domain d3bpna_: 3bpn A: [155488]
   Other proteins in same PDB: d3bpnb1, d3bpnb2, d3bpnb3
   automated match to d1itma_
   complexed with nag

Details for d3bpna_

PDB Entry: 3bpn, 3.02 Å

PDB Description: crystal structure of the il4-il4r-il13ra ternary complex

PDB Compounds: (A:) interleukin-4

SCOPe Domain Sequences for d3bpna_:

Sequence; same for both SEQRES and ATOM records:

>d3bpna_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
cditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhekd
trclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktimre
kyskcs

Timeline for d3bpna_:

• d3bpna_ first appeared in SCOP 1.75, called d3bpna1
  
• d3bpna_ appears in SCOPe 2.05
  
• d3bpna_ appears in SCOPe 2.07
  
• d3bpna_ appears in the current release, SCOPe 2.08