| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
| Protein Interleukin-4 (IL-4) [47291] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47292] (18 PDB entries) |
| Domain d3bpna_: 3bpn A: [155488] Other proteins in same PDB: d3bpnb1, d3bpnb2, d3bpnb3 automated match to d1itma_ complexed with nag |
PDB Entry: 3bpn (more details), 3.02 Å
SCOPe Domain Sequences for d3bpna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bpna_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
cditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhekd
trclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktimre
kyskcs
Timeline for d3bpna_: