SCOP 1.75: Domain d3bplc1: 3bpl C:34-129

Lineage for d3bplc1 (3bpl C:34-129)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Cytokine receptor common gamma chain [141041] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141042] (3 PDB entries)
   Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141

8. Domain d3bplc1: 3bpl C:34-129 [155486]
   Other proteins in same PDB: d3bpla1
   automatically matched to d2erjc1
   complexed with fuc, nag

Details for d3bplc1

PDB Entry: 3bpl, 2.93 Å

PDB Description: crystal structure of the il4-il4r-common gamma ternary complex

PDB Compounds: (C:) Cytokine receptor common gamma chain

SCOP Domain Sequences for d3bplc1:

Sequence; same for both SEQRES and ATOM records:

>d3bplc1 b.1.2.1 (C:34-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
plpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeitsgc
qlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl

Timeline for d3bplc1:

• d3bplc1 is new in SCOP 1.75
  
• d3bplc1 appears in SCOPe 2.01
  
• d3bplc1 appears in the current release, SCOPe 2.08