SCOP 1.75: Domain d3bpla1: 3bpl A:3-128

Lineage for d3bpla1 (3bpl A:3-128)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (13 proteins)

6. Protein Interleukin-4 (IL-4) [47291] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47292] (16 PDB entries)

8. Domain d3bpla1: 3bpl A:3-128 [155485]
   Other proteins in same PDB: d3bplc1, d3bplc2
   automatically matched to d1itla_
   complexed with fuc, nag

Details for d3bpla1

PDB Entry: 3bpl, 2.93 Å

PDB Description: crystal structure of the il4-il4r-common gamma ternary complex

PDB Compounds: (A:) interleukin-4

SCOP Domain Sequences for d3bpla1:

Sequence; same for both SEQRES and ATOM records:

>d3bpla1 a.26.1.2 (A:3-128) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
cditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhekd
trclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktimre
kyskcs

Timeline for d3bpla1:

• d3bpla1 is new in SCOP 1.75
  
• d3bpla1 is called d3bpla_ in SCOPe 2.01
  
• d3bpla1 appears in the current release, SCOPe 2.08, called d3bpla_