SCOP 1.67: Domain d1hbsf_: 1hbs F:

Lineage for d1hbsf_ (1hbs F:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (19 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (114 PDB entries)

8. Domain d1hbsf_: 1hbs F: [15548]
   Other proteins in same PDB: d1hbsa_, d1hbsc_, d1hbse_, d1hbsg_

Details for d1hbsf_

PDB Entry: 1hbs, 3 Å

PDB Description: refined crystal structure of deoxyhemoglobin s. i. restrained least-squares refinement at 3.0-angstroms resolution

SCOP Domain Sequences for d1hbsf_:

Sequence; same for both SEQRES and ATOM records:

>d1hbsf_ a.1.1.2 (F:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1hbsf_:

• d1hbsf_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbsf_ appears in SCOP 1.65
  
• d1hbsf_ appears in SCOP 1.69
  
• d1hbsf_ appears in the current release, SCOPe 2.08