Lineage for d3bpdb2 (3bpd B:2-90)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956338Superfamily d.58.61: MTH889-like [160363] (2 families) (S)
    assembles into hexameric ring-like structures with the formation of a singe beta-barrel sheet of 24 strands
  5. 2956339Family d.58.61.1: MTH889-like [160364] (2 proteins)
    Pfam PF02680; DUF211, COG1888
  6. 2956340Protein Uncharacterized protein AF1549 [160367] (1 species)
  7. 2956341Species Archaeoglobus fulgidus [TaxId:2234] [160368] (1 PDB entry)
    Uniprot O28723 1-91
  8. 2956343Domain d3bpdb2: 3bpd B:2-90 [155472]
    Other proteins in same PDB: d3bpda2, d3bpda3, d3bpdb3, d3bpdc3, d3bpdd3, d3bpdd4, d3bpde3, d3bpdf3, d3bpdf4, d3bpdg3, d3bpdh3, d3bpdi3, d3bpdj3, d3bpdk3, d3bpdk4, d3bpdl3, d3bpdm3, d3bpdn3
    automated match to d3bpda1
    complexed with mg

Details for d3bpdb2

PDB Entry: 3bpd (more details), 2.8 Å

PDB Description: crystal structure of an uncharacterized protein (o28723_arcfu) from archaeoglobus fulgidus
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3bpdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpdb2 d.58.61.1 (B:2-90) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]}
kglrrlvldvlkphepktivfalklselenvdgvnihlseidqatenikitilgnnldye
qikgviedmggvihsvdevvagkiivesv

SCOPe Domain Coordinates for d3bpdb2:

Click to download the PDB-style file with coordinates for d3bpdb2.
(The format of our PDB-style files is described here.)

Timeline for d3bpdb2: