| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.61: MTH889-like [160363] (2 families) ![]() assembles into hexameric ring-like structures with the formation of a singe beta-barrel sheet of 24 strands |
| Family d.58.61.1: MTH889-like [160364] (2 proteins) Pfam PF02680; DUF211, COG1888 |
| Protein Uncharacterized protein AF1549 [160367] (1 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [160368] (1 PDB entry) Uniprot O28723 1-91 |
| Domain d3bpdb2: 3bpd B:2-90 [155472] Other proteins in same PDB: d3bpda2, d3bpda3, d3bpdb3, d3bpdc3, d3bpdd3, d3bpdd4, d3bpde3, d3bpdf3, d3bpdf4, d3bpdg3, d3bpdh3, d3bpdi3, d3bpdj3, d3bpdk3, d3bpdk4, d3bpdl3, d3bpdm3, d3bpdn3 automated match to d3bpda1 complexed with mg |
PDB Entry: 3bpd (more details), 2.8 Å
SCOPe Domain Sequences for d3bpdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bpdb2 d.58.61.1 (B:2-90) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]}
kglrrlvldvlkphepktivfalklselenvdgvnihlseidqatenikitilgnnldye
qikgviedmggvihsvdevvagkiivesv
Timeline for d3bpdb2:
View in 3DDomains from other chains: (mouse over for more information) d3bpda1, d3bpda2, d3bpda3, d3bpdc2, d3bpdc3, d3bpdd2, d3bpdd3, d3bpdd4, d3bpde2, d3bpde3, d3bpdf2, d3bpdf3, d3bpdf4, d3bpdg2, d3bpdg3, d3bpdh2, d3bpdh3, d3bpdi2, d3bpdi3, d3bpdj2, d3bpdj3, d3bpdk2, d3bpdk3, d3bpdk4, d3bpdl2, d3bpdl3, d3bpdm2, d3bpdm3, d3bpdn2, d3bpdn3 |