Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) |
Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein) |
Protein Glucose permease domain IIB [55606] (1 species) |
Species Escherichia coli [TaxId:562] [55607] (4 PDB entries) there are differences in secondary structure packing between the two NMR-determined structures |
Domain d3bp8d_: 3bp8 D: [155470] Other proteins in same PDB: d3bp8a1, d3bp8a2, d3bp8a3, d3bp8b1, d3bp8b2, d3bp8b3 automated match to d1ibaa_ complexed with act, zn |
PDB Entry: 3bp8 (more details), 2.85 Å
SCOPe Domain Sequences for d3bp8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bp8d_ d.95.1.1 (D:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]} mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg tksdnlktemdeyir
Timeline for d3bp8d_: