Lineage for d3bp8c_ (3bp8 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035823Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1035824Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) (S)
  5. 1035825Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)
  6. 1035826Protein Glucose permease domain IIB [55606] (1 species)
  7. 1035827Species Escherichia coli [TaxId:562] [55607] (4 PDB entries)
    there are differences in secondary structure packing between the two NMR-determined structures
  8. 1035830Domain d3bp8c_: 3bp8 C: [155469]
    Other proteins in same PDB: d3bp8a1, d3bp8a2, d3bp8a3, d3bp8b1, d3bp8b2, d3bp8b3
    automated match to d1ibaa_
    complexed with act, zn

Details for d3bp8c_

PDB Entry: 3bp8 (more details), 2.85 Å

PDB Description: Crystal structure of Mlc/EIIB complex
PDB Compounds: (C:) PTS system glucose-specific EIICB component

SCOPe Domain Sequences for d3bp8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bp8c_ d.95.1.1 (C:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
tksdnlktemdeyir

SCOPe Domain Coordinates for d3bp8c_:

Click to download the PDB-style file with coordinates for d3bp8c_.
(The format of our PDB-style files is described here.)

Timeline for d3bp8c_: