Lineage for d3bp8b3 (3bp8 B:211-406)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995675Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 995686Protein Mlc protein [142473] (1 species)
    Making large colonies protein
  7. 995687Species Escherichia coli [TaxId:562] [142474] (2 PDB entries)
    Uniprot P50456 211-406! Uniprot P50456 82-210
  8. 995699Domain d3bp8b3: 3bp8 B:211-406 [155468]
    Other proteins in same PDB: d3bp8a1, d3bp8b1, d3bp8c_, d3bp8d_
    automatically matched to d1z6ra3
    complexed with act, zn

Details for d3bp8b3

PDB Entry: 3bp8 (more details), 2.85 Å

PDB Description: Crystal structure of Mlc/EIIB complex
PDB Compounds: (B:) Putative NAGC-like transcriptional regulator

SCOPe Domain Sequences for d3bp8b3:

Sequence, based on SEQRES records: (download)

>d3bp8b3 c.55.1.10 (B:211-406) Mlc protein {Escherichia coli [TaxId: 562]}
gardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgcletias
vdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgrilaimv
nlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnqgtmagaalv
kdamyngsllirllqg

Sequence, based on observed residues (ATOM records): (download)

>d3bp8b3 c.55.1.10 (B:211-406) Mlc protein {Escherichia coli [TaxId: 562]}
gardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgcletias
vdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgrilaimv
nlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnmagaalvkda
myngsllirllqg

SCOPe Domain Coordinates for d3bp8b3:

Click to download the PDB-style file with coordinates for d3bp8b3.
(The format of our PDB-style files is described here.)

Timeline for d3bp8b3: