Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
Protein Mlc protein [142473] (1 species) Making large colonies protein |
Species Escherichia coli [TaxId:562] [142474] (2 PDB entries) Uniprot P50456 211-406! Uniprot P50456 82-210 |
Domain d3bp8b3: 3bp8 B:211-406 [155468] Other proteins in same PDB: d3bp8a1, d3bp8b1, d3bp8c_, d3bp8d_ automatically matched to d1z6ra3 complexed with act, zn |
PDB Entry: 3bp8 (more details), 2.85 Å
SCOPe Domain Sequences for d3bp8b3:
Sequence, based on SEQRES records: (download)
>d3bp8b3 c.55.1.10 (B:211-406) Mlc protein {Escherichia coli [TaxId: 562]} gardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgcletias vdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgrilaimv nlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnqgtmagaalv kdamyngsllirllqg
>d3bp8b3 c.55.1.10 (B:211-406) Mlc protein {Escherichia coli [TaxId: 562]} gardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgcletias vdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgrilaimv nlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnmagaalvkda myngsllirllqg
Timeline for d3bp8b3: