![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
![]() | Protein Mlc protein [142473] (1 species) Making large colonies protein |
![]() | Species Escherichia coli [TaxId:562] [142474] (2 PDB entries) Uniprot P50456 211-406! Uniprot P50456 82-210 |
![]() | Domain d3bp8b2: 3bp8 B:82-210 [155467] Other proteins in same PDB: d3bp8a1, d3bp8b1, d3bp8c1, d3bp8d1 automatically matched to d1z6ra2 complexed with act, zn |
PDB Entry: 3bp8 (more details), 2.85 Å
SCOP Domain Sequences for d3bp8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bp8b2 c.55.1.10 (B:82-210) Mlc protein {Escherichia coli [TaxId: 562]} teawhylslrisrgeiflalrdlssklvveesqelalkddsplldriishidqffirhqk klerltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtm aealfgasr
Timeline for d3bp8b2: