SCOPe 2.01: Domain d3bp8b1: 3bp8 B:12-81

Lineage for d3bp8b1 (3bp8 B:12-81)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.63: ROK associated domain [140279] (3 proteins)
   found N-terminal to ROK domain in some proteins

6. Protein Mlc protein N-terminal domain [140280] (1 species)

7. Species Escherichia coli [TaxId:562] [140281] (2 PDB entries)
   Uniprot P50456 12-81

8. Domain d3bp8b1: 3bp8 B:12-81 [155466]
   Other proteins in same PDB: d3bp8a2, d3bp8a3, d3bp8b2, d3bp8b3, d3bp8c_, d3bp8d_
   automatically matched to d1z6ra1
   complexed with act, zn

Details for d3bp8b1

PDB Entry: 3bp8, 2.85 Å

PDB Description: Crystal structure of Mlc/EIIB complex

PDB Compounds: (B:) Putative NAGC-like transcriptional regulator

SCOPe Domain Sequences for d3bp8b1:

Sequence, based on SEQRES records:

>d3bp8b1 a.4.5.63 (B:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivremleahlvqeleikeagnr
grpavglvve

Sequence, based on observed residues (ATOM records):

>d3bp8b1 a.4.5.63 (B:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivremleahlvqelvglvve

Timeline for d3bp8b1:

• d3bp8b1 first appeared in SCOP 1.75
  
• d3bp8b1 appears in SCOPe 2.02
  
• d3bp8b1 appears in the current release, SCOPe 2.08