Lineage for d3bp8a1 (3bp8 A:11-81)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722689Family a.4.5.63: ROK associated domain [140279] (3 proteins)
    found N-terminal to ROK domain in some proteins
  6. 1722690Protein Mlc protein N-terminal domain [140280] (1 species)
  7. 1722691Species Escherichia coli [TaxId:562] [140281] (2 PDB entries)
    Uniprot P50456 12-81
  8. 1722696Domain d3bp8a1: 3bp8 A:11-81 [155463]
    Other proteins in same PDB: d3bp8a2, d3bp8a3, d3bp8b2, d3bp8b3, d3bp8c_, d3bp8d_
    automated match to d1z6ra1
    complexed with act, zn

Details for d3bp8a1

PDB Entry: 3bp8 (more details), 2.85 Å

PDB Description: Crystal structure of Mlc/EIIB complex
PDB Compounds: (A:) Putative NAGC-like transcriptional regulator

SCOPe Domain Sequences for d3bp8a1:

Sequence, based on SEQRES records: (download)

>d3bp8a1 a.4.5.63 (A:11-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
dqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivremleahlvqeleikeagn
rgrpavglvve

Sequence, based on observed residues (ATOM records): (download)

>d3bp8a1 a.4.5.63 (A:11-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
dqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivremleahlvqelevglvve

SCOPe Domain Coordinates for d3bp8a1:

Click to download the PDB-style file with coordinates for d3bp8a1.
(The format of our PDB-style files is described here.)

Timeline for d3bp8a1: