Lineage for d3bp5a_ (3bp5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741861Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 2741888Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries)
  8. 2741891Domain d3bp5a_: 3bp5 A: [155462]
    automated match to d1npua_
    complexed with gol

Details for d3bp5a_

PDB Entry: 3bp5 (more details), 1.8 Å

PDB Description: crystal structure of the mouse pd-1 and pd-l2 complex
PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d3bp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bp5a_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvter

SCOPe Domain Coordinates for d3bp5a_:

Click to download the PDB-style file with coordinates for d3bp5a_.
(The format of our PDB-style files is described here.)

Timeline for d3bp5a_: