Lineage for d3boyc_ (3boy C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052640Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 1052641Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
  5. 1052642Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)
  6. 1052643Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 1052644Species Bacillus subtilis [TaxId:1423] [111067] (3 PDB entries)
    Uniprot P10943
  8. 1052647Domain d3boyc_: 3boy C: [155461]
    automated match to d1veab_
    protein/RNA complex; complexed with his, mg

Details for d3boyc_

PDB Entry: 3boy (more details), 1.7 Å

PDB Description: crystal structure of the hutp antitermination complex bound to the hut mrna
PDB Compounds: (C:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d3boyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3boyc_ d.275.1.1 (C:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

SCOPe Domain Coordinates for d3boyc_:

Click to download the PDB-style file with coordinates for d3boyc_.
(The format of our PDB-style files is described here.)

Timeline for d3boyc_: