SCOPe 2.01: Domain d3boyb_: 3boy B:

Lineage for d3boyb_ (3boy B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)

6. Protein Hut operon positive regulatory protein HutP [111066] (1 species)
   an RNA-binding antitermination protein

7. Species Bacillus subtilis [TaxId:1423] [111067] (3 PDB entries)
   Uniprot P10943

8. Domain d3boyb_: 3boy B: [155460]
   automated match to d1veab_
   protein/RNA complex; complexed with his, mg

Details for d3boyb_

PDB Entry: 3boy, 1.7 Å

PDB Description: crystal structure of the hutp antitermination complex bound to the hut mrna

PDB Compounds: (B:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d3boyb_:

Sequence; same for both SEQRES and ATOM records:

>d3boyb_ d.275.1.1 (B:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

Timeline for d3boyb_:

• d3boyb_ first appeared in SCOP 1.75, called d3boyb1
  
• d3boyb_ appears in SCOPe 2.02
  
• d3boyb_ appears in the current release, SCOPe 2.08