Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily) alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234 |
Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) automatically mapped to Pfam PF09021 |
Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins) |
Protein Hut operon positive regulatory protein HutP [111066] (1 species) an RNA-binding antitermination protein |
Species Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries) Uniprot P10943 |
Domain d3boyb_: 3boy B: [155460] automated match to d1veab_ protein/RNA complex; complexed with his, mg |
PDB Entry: 3boy (more details), 1.7 Å
SCOPe Domain Sequences for d3boyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3boyb_ d.275.1.1 (B:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]} tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi avslygtigapikglehetfgvginhi
Timeline for d3boyb_: